Ljetna tvornica znanosti / Summer Science Factory

01.08.2008., petak

Bioinformatika

Danas smo ponavljali sve što smo radili u protekla četiri dana kako bi učvrstili naučeno. Podijelili smo se u dvije grupe. Mi smo dobili zadatak da nađemo gen za laktazu, protein, konzervirane domene i 3D sekvence od Bos Taurusa, odnosno goveda, a onda ih usporedimo sa njegovim dalekim rođacima.
Prvo smo tražili gen i protein. Gen smo našli pomoću programa Blast.
Kad smo ga našli, bilo nam ga je lako usporediti. Uspoređivali smo ga u Emboss-u. Koristili smo Dottup, Nedlee i Water.

Kada koristite Dottup, morate unijeti dva fasta zapisa od ljudskih, životinjskih ili biljnih gena ili proteina.
Fasta zapis gena vam se sastoji od samo četiri vrste slova, koji označavaju nukleotide. To su slova A, T, G i C, koji se ponavljaju oko par stotina puta. Evo vam i primjer:

AATGCGGCTATTAGGCGCGCTTTAGCTGGCACGCAGCTCGCTCAT
TGACAAAGGAGGCAAGAATATACAATGGGGCAAAGACAGCCTCTTC
AACAAATGGTGCTGGTTCCAAATAGGAAAAGGAGTATATCAAGACTA
TATATTGTCACCATGCTTATTTAACTTACCTGCAGAGTACATCATGA
GAAACGCTGGGCTGGAGGACGCACAAGCTGGAATCAAGATTGCCA
GGAGAAATATCAATAACCTCAGATATGCAGATGAAACCACCTTTATG
GCAGAAAGCGAAGAAAAACTAAAGAGCGTCTTGATGAAAGTGAAAGA
GGAGAGTGAAAAAATTGGCTTAAAGCTCAACATTCAGAAAACAAAGA



Fasta zapis proteina se sastoji od dvadeset vrsta slova koja mi ne možemo (ni nemoramo) zapamtiti. Ta slova označavaju aminokiseline. I isto se ponavljaju po par stotina puta. A evo vam i taj primjer:

MSRPLPYHIHFFSGLLTCWILCTSSAHKCTVRHEVADCSHLKLTQIPDDL
PTNITVLNLTHNQLRRLPPANFTRYSQLTTLDGGFNSISKLEPELCQSLP
WLEILNLQHNEISQLSDKTFIFCMNLTELHLMSNSIQKIKNDPFKNLKNLIK
LDLSHNGLSSTKLGTQLQLENLQELLLSNNKISSLTPGEFDFLGNSSLKR
ELSSNQIKEFSPGCFHTLGELSGLSLNNAKLSPSLTEKLCLELSNTSIENL
SLSSNQLDTISHTTFDGLKQTNLTTLDLSRNSLRVMGNDSFAWLPHLEY
LSLEYNNIEHLSSRSFYGLSNLRRLDLRRSFTRQSISLTSLPKIDDF

I kad unesete dva gena ili dva proteina, ovisno o tome šta tražite, dobijete sliku koja izgleda otprilike ovako:

Image Hosted by ImageShack.us


E sad: Ove crne crtice vam označavaju sličnosti, a gdje ih nema, to je različito. Te crne male točkice označavaju male sličnosti, a kad vidite veliku dijagonalnu crtu, to znači da je tu velika sačuvana sličnost.

Onda smo radili u nedlee-u. To je program za globalno uspoređivanje DNA ili proteina. Uspoređivali smo DNA i proteine čovjeka i Bos Taurusa. Evo vam rezultati DNA:

Aligned_sequences: 2
# 1: M61834
# 2:
# Matrix: EDNAFULL
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 3199
# Identity: 1336/3199 (41.8%)
# Similarity: 1336/3199 (41.8%)
# Gaps: 1531/3199 (47.9%)
# Score: 3921.0

A evo vam i od proteina:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 2086
# Identity: 223/2086 (10.7%)
# Similarity: 373/2086 (17.9%)
# Gaps: 1341/2086 (64.3%)
# Score: 71.0

Vidite, DNA se poklapa 41,8 %, a protein 17,9%. Znači da imaju sličnije DNA-ove nego proteine

Nakon toga smo istraživali u Water-u.To je program koji pokazuje najsličniji dio između DNA-ova ili proteina.
Evo rezultata:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 1182
# Identity: 208/1182 (17.6%)
# Similarity: 349/1182 (29.5%)
# Gaps: 492/1182 (41.6%)
# Score: 79.5

A evo proteina:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 1182
# Identity: 208/1182 (17.6%)
# Similarity: 349/1182 (29.5%)
# Gaps: 492/1182 (41.6%)
# Score: 79.5

Poslije toga smo pretraživali t-coffee koji pokazuje drvo sličnosti. On povezuje najsličnije DNA-ove i proteine.
Evo vam i jedno stablo da vidite kako to izgleda.

Image Hosted by ImageShack.us
ž

U tome stablu su vam čovjek, svinja, štakor, zec i govedo.

Poslije toga smo tražili konzervirane domene DNA-ova i proteina. To su dijelovi koji su važni pa su ostali sačuvani. Evo vam od DNA:

Image Hosted by ImageShack.us


A evo od proteina:

Image Hosted by ImageShack.us


I onda su nam samo još nedostajale 3D strukture. Pa evo, pogledajte i kako to izgleda. Tu su dvije slike, ali to je isto, samo drugačije okrenuto.

Image Hosted by ImageShack.us


Image Hosted by ImageShack.us


PyMOL je program pomoću kojega gledamo 3D strukture. Ove strelice nam pokazuju smjer u kojemu se lanac aminokiselina zamotao.

Pa eto mi smo to radili danas. Puno pozdrava od Maka, Lane, Roka, Borne i

<< Arhiva >>

Creative Commons License
Ovaj blog je ustupljen pod Creative Commons licencom Imenovanje-Dijeli pod istim uvjetima.

Blog.hr koristi kolačiće za pružanje boljeg korisničkog iskustva. Postavke kolačića mogu se kontrolirati i konfigurirati u vašem web pregledniku. Više o kolačićima možete pročitati ovdje. Nastavkom pregleda web stranice Blog.hr slažete se s korištenjem kolačića. Za nastavak pregleda i korištenja web stranice Blog.hr kliknite na gumb "Slažem se".Slažem se