Ljetna tvornica znanosti / Summer Science Factory

13.08.2008., srijeda

U pauzi ...

Radionica je gotova, no to ne znači da mi nemamo još toga za objaviti. Slijedi nekoliko video uradaka koje je posložio Duje od materijala koje je snimala cijela grupa koja se bavila hidroelektranom. Ima tu svega i svačega ;)

˙





btw možete naći i jednu fotogaleriju ako vas više zanimaju slike. Komentari na slike su još u povojima, ali negdje u skroj budućnosti će i to biti malo informativnije ;)

02.08.2008., subota

Konstruiranje hidro elektrane

Sada pisemo mi tj. grupa magnetizma...

Nazalost prije tri dana nismo stigli napisati sto smo radili pa moramo to danas obaviti...Jucer smo izasli u prirodu i ponavljali napravljeno.Ponavljali smo o zavojnicama,struji, naponima i ostalo...bilo je jako zanimljivo jer smo radili u prirodi i imali smo "friski" zrak.Nakon toga smo smisljali kako napraviti hidroelektranu,bilo je jako tesko i nismo stigli to uraditi do stanke ali je bilo zanimljivo i puno pogadanja.Nakon stanke smo dosli do kemicara tj. kiseline u zivom svijetu.Kod njih smo radili pokuse oko kristala,vatre,amonijaka... Sa amonijakom smo proizvodili neki "smrdeci miris".

Prekjucer smo pokusavali konstruirati hidro elektranu koju nismo stigli jucer napraviti, zapravo nismo ni stigli smisliti kako bi to izgledalo.Nakon nekog vremena smislili smo kako cemo to napraviti uz materijal koji smo dobili. Od kanistera smo napravili kuciste i u njemu ce se nalaziti hidroelektrana.Poslije smo morali drugim grupama objasnjavati sto smo mi dosad radili. Bilo je zanimljivo ali kratko, samo 30 minuta smo bili s drugim grupama ali ipak je na kraju to bilo jedno poucno iskustvo.


Jucer smo morali motati bakar oko zeljezne jezgre.Tu je bilo jako puno posla, morali smo motati 160 metara tj. 1000 zavoja.To smo radili 3-4 sata i bilo je zanimljivo jer smo pricali o tome kako cemo dobiti puno struje i sl. tako da je sve to brzo proslo.Nakon toga smo otisli u institut i izmjerili napon sa voltmetrom, i dobili smo napon od 3 volta sto je bilo vise nego zadoljavajuce.

Danas je zadnji dan radionice jer je sutra prezentacija roditeljima sto smo dosad napravili, ali najprije moramo dovrsiti hidro elektranu.Napravili smo vecinu posla tako da ce nam danas ostati vremena za uciti govor za sutra.Otprilike cemo biti gotovi za 2-3 sata i onda cemo isprobati radi li to...kad zavrsimo dobit cete slike hidro elektrane.


01.08.2008., petak

biolozi

ovo je stvarno super mi se zabavljamo i danas smo išli na more na titovo kupalište stvarno je zakon dođite i vi sljedeće godine pozz

Bioinformatika

Danas smo ponavljali sve što smo radili u protekla četiri dana kako bi učvrstili naučeno. Podijelili smo se u dvije grupe. Mi smo dobili zadatak da nađemo gen za laktazu, protein, konzervirane domene i 3D sekvence od Bos Taurusa, odnosno goveda, a onda ih usporedimo sa njegovim dalekim rođacima.
Prvo smo tražili gen i protein. Gen smo našli pomoću programa Blast.
Kad smo ga našli, bilo nam ga je lako usporediti. Uspoređivali smo ga u Emboss-u. Koristili smo Dottup, Nedlee i Water.

Kada koristite Dottup, morate unijeti dva fasta zapisa od ljudskih, životinjskih ili biljnih gena ili proteina.
Fasta zapis gena vam se sastoji od samo četiri vrste slova, koji označavaju nukleotide. To su slova A, T, G i C, koji se ponavljaju oko par stotina puta. Evo vam i primjer:

AATGCGGCTATTAGGCGCGCTTTAGCTGGCACGCAGCTCGCTCAT
TGACAAAGGAGGCAAGAATATACAATGGGGCAAAGACAGCCTCTTC
AACAAATGGTGCTGGTTCCAAATAGGAAAAGGAGTATATCAAGACTA
TATATTGTCACCATGCTTATTTAACTTACCTGCAGAGTACATCATGA
GAAACGCTGGGCTGGAGGACGCACAAGCTGGAATCAAGATTGCCA
GGAGAAATATCAATAACCTCAGATATGCAGATGAAACCACCTTTATG
GCAGAAAGCGAAGAAAAACTAAAGAGCGTCTTGATGAAAGTGAAAGA
GGAGAGTGAAAAAATTGGCTTAAAGCTCAACATTCAGAAAACAAAGA



Fasta zapis proteina se sastoji od dvadeset vrsta slova koja mi ne možemo (ni nemoramo) zapamtiti. Ta slova označavaju aminokiseline. I isto se ponavljaju po par stotina puta. A evo vam i taj primjer:

MSRPLPYHIHFFSGLLTCWILCTSSAHKCTVRHEVADCSHLKLTQIPDDL
PTNITVLNLTHNQLRRLPPANFTRYSQLTTLDGGFNSISKLEPELCQSLP
WLEILNLQHNEISQLSDKTFIFCMNLTELHLMSNSIQKIKNDPFKNLKNLIK
LDLSHNGLSSTKLGTQLQLENLQELLLSNNKISSLTPGEFDFLGNSSLKR
ELSSNQIKEFSPGCFHTLGELSGLSLNNAKLSPSLTEKLCLELSNTSIENL
SLSSNQLDTISHTTFDGLKQTNLTTLDLSRNSLRVMGNDSFAWLPHLEY
LSLEYNNIEHLSSRSFYGLSNLRRLDLRRSFTRQSISLTSLPKIDDF

I kad unesete dva gena ili dva proteina, ovisno o tome šta tražite, dobijete sliku koja izgleda otprilike ovako:

Image Hosted by ImageShack.us


E sad: Ove crne crtice vam označavaju sličnosti, a gdje ih nema, to je različito. Te crne male točkice označavaju male sličnosti, a kad vidite veliku dijagonalnu crtu, to znači da je tu velika sačuvana sličnost.

Onda smo radili u nedlee-u. To je program za globalno uspoređivanje DNA ili proteina. Uspoređivali smo DNA i proteine čovjeka i Bos Taurusa. Evo vam rezultati DNA:

Aligned_sequences: 2
# 1: M61834
# 2:
# Matrix: EDNAFULL
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 3199
# Identity: 1336/3199 (41.8%)
# Similarity: 1336/3199 (41.8%)
# Gaps: 1531/3199 (47.9%)
# Score: 3921.0

A evo vam i od proteina:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 2086
# Identity: 223/2086 (10.7%)
# Similarity: 373/2086 (17.9%)
# Gaps: 1341/2086 (64.3%)
# Score: 71.0

Vidite, DNA se poklapa 41,8 %, a protein 17,9%. Znači da imaju sličnije DNA-ove nego proteine

Nakon toga smo istraživali u Water-u.To je program koji pokazuje najsličniji dio između DNA-ova ili proteina.
Evo rezultata:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 1182
# Identity: 208/1182 (17.6%)
# Similarity: 349/1182 (29.5%)
# Gaps: 492/1182 (41.6%)
# Score: 79.5

A evo proteina:

Aligned_sequences: 2
# 1:
# 2:
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 1182
# Identity: 208/1182 (17.6%)
# Similarity: 349/1182 (29.5%)
# Gaps: 492/1182 (41.6%)
# Score: 79.5

Poslije toga smo pretraživali t-coffee koji pokazuje drvo sličnosti. On povezuje najsličnije DNA-ove i proteine.
Evo vam i jedno stablo da vidite kako to izgleda.

Image Hosted by ImageShack.us
ž

U tome stablu su vam čovjek, svinja, štakor, zec i govedo.

Poslije toga smo tražili konzervirane domene DNA-ova i proteina. To su dijelovi koji su važni pa su ostali sačuvani. Evo vam od DNA:

Image Hosted by ImageShack.us


A evo od proteina:

Image Hosted by ImageShack.us


I onda su nam samo još nedostajale 3D strukture. Pa evo, pogledajte i kako to izgleda. Tu su dvije slike, ali to je isto, samo drugačije okrenuto.

Image Hosted by ImageShack.us


Image Hosted by ImageShack.us


PyMOL je program pomoću kojega gledamo 3D strukture. Ove strelice nam pokazuju smjer u kojemu se lanac aminokiselina zamotao.

Pa eto mi smo to radili danas. Puno pozdrava od Maka, Lane, Roka, Borne i

biolozi

blog vam je super mi stalno istrazujjemo kukce i ptice poz

31.07.2008., četvrtak

---> opijati

ugl, mi smo grupa opijata i proučavamo čaj, kavu i čokoladu kojima smo posvetili dane...yes
rofl

Kompjutorske igrice


Kompjutorske igrice su izvor života.Na njima se možete voziti,trčati,skakati,letjeti,itd. Njih igraju odrasli i djeca jer su imaju dosta žanra,pucačine,strategije,simulacije... Pružaju vam 24-satnu zabavu sjedeći za računalom.Igrice se igraju diljem svijeta, igraju se na raznim konzolama.Na primjer playstationu,nitendu,gameboyu,xboxu pa i na psp(playstation portable).Postoje razne igre,a najprodavanija je world of warcraft, ona stvara najvecu ovisnost od svih igara,neznam zašto,ali je strašno dosadna.Jako je skupa, 300 kn mjesečno. Meni je jako dosadna i ne pomisljam da je igram.


Besplatan upload slika i fotografija
Besplatan upload slika i fotografija

Bioinformatika

Mi smo grupa bioinformatičarawave waveZadatak nam je istražiti zašto neki ljudi imaju problema sa probavljanjem mlijeka. zujo U tome nam pomažu mnogi programi na internetu:EMBOSS, OMIM, SRS (ne srpska radikalna stranka, da ne bi bilo zabune), BLAST, T-COFFEE,... Istražujemo razlike između DNA-ova čovjeka i razno raznih životinja.

Image Hosted by ImageShack.us


Image Hosted by ImageShack.us


Jeste li znali da su čovjek i štakor jako slični?
Pa mi sigurno nismo

Image Hosted by ImageShack.us


Iako smo bioinformatičari, ne radimo sve u računalnoj. Danas smo u laboratoriju izolirali DNA od svega i svačega.
Šljive, grašak, bršljan i prijatelji, meso pa čak i kosti krave. Dosta smo se izmučili dok smo ribali kost, ali isplatilo se. Najviše DNA dobili smo iz nje, iako smo je imali najmanje.

Image Hosted by ImageShack.us


Da, da,... Bilo je i lomljenja. zubo Dobro, ajde, nećemo o tome.
A da ne bi bilo da samo radimo, imamo i pauze. thumbup
Stvarno smo prvaci u smišljanju načina kako da popunimo slobodno vrijeme.
Neki jednostavno čeprkaju po internetu, neki provjeravaju mail, a neki crtaju slokoši i ostale hibride.lud Slokoš je mješanac između slona i kokoši. Imamo je u sto različitih veličina i boja. naughty
A evo i neki hibrid koji prdi. Napravio ga je jedini muški član naše grupe, Roko. Ma hibrid je neka zaštićena vrsta s vrhova Velebita. A najviše voli fažol s Mosora. To objašnjava zašto pušta vjetrove.

Image Hosted by ImageShack.us


Al dobro, dosta o tome.
Preko pauze igramo košarku i stolni tenis.partyparty Dobro nan dođe poslije toliko sjedenja. deaddead
Evo složili smo se da je ovo dosta za danas.
Pozdravi od Maka, Borne, Roka, Lane i Lucie! wavemah


29.07.2008., utorak

Rad sa Zavojnicama i strujom

Danas smo opet u MEDILS-u .Krenuli smo na rad sa zavojnicama,strujom,naponom...


Prvo smo dobili komad kartona od kojeg smo trebali napraviti trokut ili krug kroz koji je morao proci magnet. Karton je bio tvrd pa nismo tako brzo mogli napraviti pravi oblik.Nakon toga smo trebali izmjeriti opseg od tih oblika, onda smo dobili zadatak koliko cemo metara bakra omotati.Dobili smo mjere oko 20 metara a neki vise tj. manje.Jako smo dugo omotavali bakar oko trokuta i krugova, ali je jako bilo zabavno i zanimljivo.Vrhova bakra smo morali izbrusiti sa skalperom.Te vrhove bi pricvrstili na "grickalice".Onda smo poceli mjeriti napon u volitma, 0.8 volta je bio najveci napon kojeg smo dobili, s cim smo naravno bili zadovoljni.

Nakon toga smo uzeli lampice koje smo pokusavali upaliti s nasim radovima.Samo je Stjepanov karton od bakra uspio upaliti lampicu,mi nismo imali dovoljno struje za to upaliti.


Onda smo pokusavali upaliti lampice pomocu bakra i kartona s kojim smo radili prije.Spojili smo sve kartone od bakra (bilo ih je 6) ali nismo uspjeli upaliti zbog toga sto nismo u isto vrijeme spustit magnet kroz otvor od kartona.

28.07.2008., ponedjeljak

Proucavanje magneta


Danas smo došli u centar MEDILS koji se bavi raznim zanimljivim stvarima, kao,Priroda,Tehnićki,Informatika,Biologija,Kemija...

Danas smo radili s magnetima, utvrđivali smo koji je južni i sjeverni pol uz pomoč kompasa.Kad smo odredili strane na sjevernu smo stavili crnu traku kako ne bi zaboravili koja je prava strana jer nam je to poslije bilo jako važno...

Uzeli smo kemijsku, iz nje smo izvadili tintu i pripremili se na "piljenje" .Ispilili smo gornji dio olovke kako bi nam mogao unutra ući magnet, ali prije magneta smo morali izrezati malo bakra i omotali ga oko kemijske.Da nam to ne bi "izlazilo" omotali smo bakar crnom trakom.Sada smo stavlili magnet u kemijsku i izmjerili smo napon s voltmetrom. Dobili smo napon od 6 milivolti,sto nije bas puno ali je bilo zanimljivo.


Besplatan upload slika i fotografija

<< Arhiva >>

Creative Commons License
Ovaj blog je ustupljen pod Creative Commons licencom Imenovanje-Dijeli pod istim uvjetima.

Blog.hr koristi kolačiće za pružanje boljeg korisničkog iskustva. Postavke kolačića mogu se kontrolirati i konfigurirati u vašem web pregledniku. Više o kolačićima možete pročitati ovdje. Nastavkom pregleda web stranice Blog.hr slažete se s korištenjem kolačića. Za nastavak pregleda i korištenja web stranice Blog.hr kliknite na gumb "Slažem se".Slažem se